| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein automated matches [190043] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries) |
| Domain d4jjda1: 4jjd A:60-121 [237615] Other proteins in same PDB: d4jjda2 automated match to d3eg3a_ complexed with na, peg; mutant |
PDB Entry: 4jjd (more details), 1.6 Å
SCOPe Domain Sequences for d4jjda1:
Sequence, based on SEQRES records: (download)
>d4jjda1 b.34.2.1 (A:60-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
endpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitpv
ns
>d4jjda1 b.34.2.1 (A:60-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
endpnlfvalydfvatlsitkgeklrvlgynhngewceaqtkngqgwvpsayitpvns
Timeline for d4jjda1: