SCOPe 2.08: Domain d4jjda1: 4jjd A:60-121

Lineage for d4jjda1 (4jjd A:60-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d4jjda1: 4jjd A:60-121 [237615]
   Other proteins in same PDB: d4jjda2
   automated match to d3eg3a_
   complexed with na, peg; mutant

Details for d4jjda1

PDB Entry: 4jjd, 1.6 Å

PDB Description: Crystal structure of the N114A Abl-SH3 domain mutant at pH4

PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d4jjda1:

Sequence, based on SEQRES records:

>d4jjda1 b.34.2.1 (A:60-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
endpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsayitpv
ns

Sequence, based on observed residues (ATOM records):

>d4jjda1 b.34.2.1 (A:60-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}
endpnlfvalydfvatlsitkgeklrvlgynhngewceaqtkngqgwvpsayitpvns

Timeline for d4jjda1:

• d4jjda1 first appeared in SCOPe 2.03, called d4jjda_
  
• d4jjda1 appears in SCOPe 2.07