SCOPe 2.03: Domain d4gsna2: 4gsn A:87-220

Lineage for d4gsna2 (4gsn A:87-220)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225348] (4 PDB entries)

8. Domain d4gsna2: 4gsn A:87-220 [237604]
   Other proteins in same PDB: d4gsna1, d4gsnb1, d4gsnc1, d4gsnd1
   automated match to d2il3a2
   complexed with 1pe, gol, gsh

Details for d4gsna2

PDB Entry: 4gsn, 2.3 Å

PDB Description: crystal structure of gste2 zan/u variant from anopheles gambiae

PDB Compounds: (A:) glutathione s-transferase e2

SCOPe Domain Sequences for d4gsna2:

Sequence; same for both SEQRES and ATOM records:

>d4gsna2 a.45.1.0 (A:87-220) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
pkdpvkqarvnsalhfesgvlfarmrftferilffgksdipedrveyvqksyelledtlv
ddfvagptmtiadfscistvssimgvvpleqskhpriyawidrlkqlpyyeevnggggtd
lgkfvlakkeenak

Timeline for d4gsna2:

• d4gsna2 is new in SCOPe 2.03-stable
  
• d4gsna2 appears in SCOPe 2.04
  
• d4gsna2 appears in the current release, SCOPe 2.08