SCOPe 2.06: Domain d4g6ic2: 4g6i C:97-199

Lineage for d4g6ic2 (4g6i C:97-199)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (20 species)
   not a true protein

7. Species Brucella abortus [TaxId:235] [228298] (4 PDB entries)

8. Domain d4g6ic2: 4g6i C:97-199 [237603]
   automated match to d4e0fa2
   complexed with rs3

Details for d4g6ic2

PDB Entry: 4g6i, 1.78 Å

PDB Description: Crystallographic structure of trimeric riboflavin synthase from Brucella abortus in complex with roseoflavin

PDB Compounds: (C:) Riboflavin synthase subunit alpha

SCOPe Domain Sequences for d4g6ic2:

Sequence; same for both SEQRES and ATOM records:

>d4g6ic2 b.43.4.0 (C:97-199) automated matches {Brucella abortus [TaxId: 235]}
emgghlvfghvdgqaeiverkdegdavrftlrapeelapfiaqkgsvaldgtsltvngvn
anefdvllirhslevttwgerkagdkvnieidqlaryaarlaq

Timeline for d4g6ic2:

• d4g6ic2 first appeared in SCOPe 2.03
  
• d4g6ic2 appears in SCOPe 2.05
  
• d4g6ic2 appears in SCOPe 2.07
  
• d4g6ic2 appears in the current release, SCOPe 2.08