SCOPe 2.08: Domain d4gsnd1: 4gsn D:2-86

Lineage for d4gsnd1 (4gsn D:2-86)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225347] (4 PDB entries)

8. Domain d4gsnd1: 4gsn D:2-86 [237588]
   Other proteins in same PDB: d4gsna2, d4gsnb2, d4gsnc2, d4gsnd2
   automated match to d2il3a1
   complexed with 1pe, gol, gsh

Details for d4gsnd1

PDB Entry: 4gsn, 2.3 Å

PDB Description: crystal structure of gste2 zan/u variant from anopheles gambiae

PDB Compounds: (D:) glutathione s-transferase e2

SCOPe Domain Sequences for d4gsnd1:

Sequence; same for both SEQRES and ATOM records:

>d4gsnd1 c.47.1.0 (D:2-86) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
snlvlytlhlsppcraveltakalgleleqktinlltgdhlkpefvklnpqhtipvlddn
gtiiteshaimiylvtkygkddsly

Timeline for d4gsnd1:

• d4gsnd1 first appeared in SCOPe 2.03
  
• d4gsnd1 appears in SCOPe 2.07