| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225347] (4 PDB entries) |
| Domain d4gsnd1: 4gsn D:2-86 [237588] Other proteins in same PDB: d4gsna2, d4gsnb2, d4gsnc2, d4gsnd2 automated match to d2il3a1 complexed with 1pe, gol, gsh |
PDB Entry: 4gsn (more details), 2.3 Å
SCOPe Domain Sequences for d4gsnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gsnd1 c.47.1.0 (D:2-86) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
snlvlytlhlsppcraveltakalgleleqktinlltgdhlkpefvklnpqhtipvlddn
gtiiteshaimiylvtkygkddsly
Timeline for d4gsnd1: