Lineage for d4gsnc1 (4gsn C:2-86)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2878976Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [225347] (4 PDB entries)
  8. 2878985Domain d4gsnc1: 4gsn C:2-86 [237587]
    Other proteins in same PDB: d4gsna2, d4gsnb2, d4gsnc2, d4gsnd2
    automated match to d2il3a1
    complexed with 1pe, gol, gsh

Details for d4gsnc1

PDB Entry: 4gsn (more details), 2.3 Å

PDB Description: crystal structure of gste2 zan/u variant from anopheles gambiae
PDB Compounds: (C:) glutathione s-transferase e2

SCOPe Domain Sequences for d4gsnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gsnc1 c.47.1.0 (C:2-86) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
snlvlytlhlsppcraveltakalgleleqktinlltgdhlkpefvklnpqhtipvlddn
gtiiteshaimiylvtkygkddsly

SCOPe Domain Coordinates for d4gsnc1:

Click to download the PDB-style file with coordinates for d4gsnc1.
(The format of our PDB-style files is described here.)

Timeline for d4gsnc1: