Lineage for d4iq2b_ (4iq2 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509610Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2509611Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2509612Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 protein domains)
  6. 2509616Protein Calcineurin (FKBP12.6) [54539] (3 species)
  7. 2509621Species Human (Homo sapiens) [TaxId:9606] [54540] (4 PDB entries)
  8. 2509625Domain d4iq2b_: 4iq2 B: [237569]
    automated match to d4iq2a_
    complexed with mla

Details for d4iq2b_

PDB Entry: 4iq2 (more details), 1.7 Å

PDB Description: p21 crystal form of fkbp12.6
PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase fkbp1b

SCOPe Domain Sequences for d4iq2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iq2b_ d.26.1.1 (B:) Calcineurin (FKBP12.6) {Human (Homo sapiens) [TaxId: 9606]}
gveietispgdgrtfpkkgqtvvvhytgmlqngkkfdssrdrnkpfkfrigkqevikgfe
egaaqmslgqrakltitpdvaygatghpgvippnatlifdvellnle

SCOPe Domain Coordinates for d4iq2b_:

Click to download the PDB-style file with coordinates for d4iq2b_.
(The format of our PDB-style files is described here.)

Timeline for d4iq2b_: