SCOPe 2.03: Domain d4c7ga2: 4c7g A:139-494

Lineage for d4c7ga2 (4c7g A:139-494)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
   Glycosyl hydrolase family 20, GH20
   automatically mapped to Pfam PF00728

6. Protein automated matches [237553] (1 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [237558] (3 PDB entries)

8. Domain d4c7ga2: 4c7g A:139-494 [237565]
   Other proteins in same PDB: d4c7ga1
   automated match to d1jaka1
   complexed with edo, ngo

Details for d4c7ga2

PDB Entry: 4c7g, 1.8 Å

PDB Description: Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2)

PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOPe Domain Sequences for d4c7ga2:

Sequence; same for both SEQRES and ATOM records:

>d4c7ga2 c.1.8.6 (A:139-494) automated matches {Streptomyces coelicolor [TaxId: 1902]}
yawrsamldvsrhffsvdevkryidrvalykynklhlhisddqgwrlaidswprlatygg
stevgggpgghytkadyeeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfstlcvdkdvtydfvddvlgelaaltpgrylhiggdqahstpqadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtsdaekaqvaaaarngtglilspad
rtyldmkytkdtplglswagyvevrrsydwdpaaylpgapaeavrgveaplwtetlsdpd
qldfmafprlpgvaelgwspasthdwdtykvrlagqaphweamgidyyrspqvpwt

Timeline for d4c7ga2:

• d4c7ga2 is new in SCOPe 2.03-stable
  
• d4c7ga2 appears in SCOPe 2.04
  
• d4c7ga2 appears in the current release, SCOPe 2.08