Lineage for d4c7fb2 (4c7f B:139-494)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094982Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2095034Protein automated matches [237553] (2 species)
    not a true protein
  7. 2095037Species Streptomyces coelicolor [TaxId:1902] [237558] (3 PDB entries)
  8. 2095042Domain d4c7fb2: 4c7f B:139-494 [237564]
    Other proteins in same PDB: d4c7fa1, d4c7fb1
    automated match to d1jaka1
    complexed with edo, gc2

Details for d4c7fb2

PDB Entry: 4c7f (more details), 2 Å

PDB Description: Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2)
PDB Compounds: (B:) beta-n-acetylhexosaminidase

SCOPe Domain Sequences for d4c7fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7fb2 c.1.8.6 (B:139-494) automated matches {Streptomyces coelicolor [TaxId: 1902]}
yawrsamldvsrhffsvdevkryidrvalykynklhlhisddqgwrlaidswprlatygg
stevgggpgghytkadyeeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl
ytgtkvgfstlcvdkdvtydfvddvlgelaaltpgrylhiggdeahstpqadfvafmkrv
qpivakygktvvgwhqlagaepvegalvqywgldrtsdaekaqvaaaarngtglilspad
rtyldmkytkdtplglswagyvevrrsydwdpaaylpgapaeavrgveaplwtetlsdpd
qldfmafprlpgvaelgwspasthdwdtykvrlagqaphweamgidyyrspqvpwt

SCOPe Domain Coordinates for d4c7fb2:

Click to download the PDB-style file with coordinates for d4c7fb2.
(The format of our PDB-style files is described here.)

Timeline for d4c7fb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c7fb1