![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins) Glycosyl hydrolase family 20, GH20 automatically mapped to Pfam PF00728 |
![]() | Protein automated matches [237553] (2 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [237558] (3 PDB entries) |
![]() | Domain d4c7fb2: 4c7f B:139-494 [237564] Other proteins in same PDB: d4c7fa1, d4c7fb1 automated match to d1jaka1 complexed with edo, gc2 |
PDB Entry: 4c7f (more details), 2 Å
SCOPe Domain Sequences for d4c7fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7fb2 c.1.8.6 (B:139-494) automated matches {Streptomyces coelicolor [TaxId: 1902]} yawrsamldvsrhffsvdevkryidrvalykynklhlhisddqgwrlaidswprlatygg stevgggpgghytkadyeeivryaasrhlevvpeidmpghtnaalasyaelncdgvappl ytgtkvgfstlcvdkdvtydfvddvlgelaaltpgrylhiggdeahstpqadfvafmkrv qpivakygktvvgwhqlagaepvegalvqywgldrtsdaekaqvaaaarngtglilspad rtyldmkytkdtplglswagyvevrrsydwdpaaylpgapaeavrgveaplwtetlsdpd qldfmafprlpgvaelgwspasthdwdtykvrlagqaphweamgidyyrspqvpwt
Timeline for d4c7fb2: