SCOPe 2.03: Domain d4c7fa1: 4c7f A:1-138

Lineage for d4c7fa1 (4c7f A:1-138)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (2 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [237537] (3 PDB entries)

8. Domain d4c7fa1: 4c7f A:1-138 [237551]
   Other proteins in same PDB: d4c7fa2, d4c7fb2
   automated match to d1jaka2
   complexed with edo, gc2

Details for d4c7fa1

PDB Entry: 4c7f, 2 Å

PDB Description: Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2)

PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOPe Domain Sequences for d4c7fa1:

Sequence; same for both SEQRES and ATOM records:

>d4c7fa1 d.92.2.0 (A:1-138) automated matches {Streptomyces coelicolor [TaxId: 1902]}
aeptpldrvipapasvepggapyritrgthirvddsrearrvgdyladllrpatgyrlpv
tshghggirlrlaegpygdegyrldsgregvtitarkaaglfhgvqtlrqllpaavekds
aqpgpwlvaggtiedtpr

Timeline for d4c7fa1:

• d4c7fa1 is new in SCOPe 2.03-stable
  
• d4c7fa1 appears in SCOPe 2.04
  
• d4c7fa1 appears in the current release, SCOPe 2.08