| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
| Protein automated matches [227062] (5 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:1902] [237537] (3 PDB entries) |
| Domain d4c7fa1: 4c7f A:1-138 [237551] Other proteins in same PDB: d4c7fa2, d4c7fb2 automated match to d1jaka2 complexed with edo, gc2 |
PDB Entry: 4c7f (more details), 2 Å
SCOPe Domain Sequences for d4c7fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7fa1 d.92.2.0 (A:1-138) automated matches {Streptomyces coelicolor [TaxId: 1902]}
aeptpldrvipapasvepggapyritrgthirvddsrearrvgdyladllrpatgyrlpv
tshghggirlrlaegpygdegyrldsgregvtitarkaaglfhgvqtlrqllpaavekds
aqpgpwlvaggtiedtpr
Timeline for d4c7fa1: