Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
Protein automated matches [227062] (4 species) not a true protein |
Species Streptomyces coelicolor [TaxId:1902] [237537] (3 PDB entries) |
Domain d4c7db1: 4c7d B:1-138 [237550] Other proteins in same PDB: d4c7da2, d4c7db2 automated match to d1jaka2 complexed with edo |
PDB Entry: 4c7d (more details), 1.85 Å
SCOPe Domain Sequences for d4c7db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c7db1 d.92.2.0 (B:1-138) automated matches {Streptomyces coelicolor [TaxId: 1902]} aeptpldrvipapasvepggapyritrgthirvddsrearrvgdyladllrpatgyrlpv tshghggirlrlaegpygdegyrldsgregvtitarkaaglfhgvqtlrqllpaavekds aqpgpwlvaggtiedtpr
Timeline for d4c7db1: