Lineage for d4c7ga1 (4c7g A:1-138)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1661743Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 1661843Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 1661844Protein automated matches [227062] (4 species)
    not a true protein
  7. 1661857Species Streptomyces coelicolor [TaxId:1902] [237537] (3 PDB entries)
  8. 1661858Domain d4c7ga1: 4c7g A:1-138 [237548]
    Other proteins in same PDB: d4c7ga2
    automated match to d1jaka2
    complexed with edo, ngo

Details for d4c7ga1

PDB Entry: 4c7g (more details), 1.8 Å

PDB Description: Structure and activity of the GH20 beta-N-acetylhexosaminidase from Streptomyces coelicolor A3(2)
PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOPe Domain Sequences for d4c7ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c7ga1 d.92.2.0 (A:1-138) automated matches {Streptomyces coelicolor [TaxId: 1902]}
aeptpldrvipapasvepggapyritrgthirvddsrearrvgdyladllrpatgyrlpv
tshghggirlrlaegpygdegyrldsgregvtitarkaaglfhgvqtlrqllpaavekds
aqpgpwlvaggtiedtpr

SCOPe Domain Coordinates for d4c7ga1:

Click to download the PDB-style file with coordinates for d4c7ga1.
(The format of our PDB-style files is described here.)

Timeline for d4c7ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c7ga2