Lineage for d3wjva_ (3wjv A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824380Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 2824381Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 2824410Family b.125.1.2: Outer membrane lipoprotein receptor LolB [89396] (1 protein)
    automatically mapped to Pfam PF03550
  6. 2824411Protein Outer membrane lipoprotein receptor LolB [89397] (1 species)
  7. 2824412Species Escherichia coli [TaxId:562] [89398] (5 PDB entries)
  8. 2824417Domain d3wjva_: 3wjv A: [237518]
    automated match to d1iwma_
    complexed with so4

Details for d3wjva_

PDB Entry: 3wjv (more details), 2.4 Å

PDB Description: Crystal structure of the L68E variant of mLolB
PDB Compounds: (A:) Outer-membrane lipoprotein LolB

SCOPe Domain Sequences for d3wjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wjva_ b.125.1.2 (A:) Outer membrane lipoprotein receptor LolB {Escherichia coli [TaxId: 562]}
kspdspqwrqhqqdvrnlnqyqtrgafayisdqqkvyarffwqqtgqdryrllltnpegs
telelnaqpgnvqlvdnkgqrytaddaeemigkltgmpiplnslrqwilglpgdatdykl
ddqyrlseitysqngknwkvvyggydtktqpampanmeltdggqriklkmdnwivk

SCOPe Domain Coordinates for d3wjva_:

Click to download the PDB-style file with coordinates for d3wjva_.
(The format of our PDB-style files is described here.)

Timeline for d3wjva_: