SCOPe 2.03: Domain d3w7cb_: 3w7c B:

Lineage for d3w7cb_ (3w7c B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (10 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [187324] (54 PDB entries)

8. Domain d3w7cb_: 3w7c B: [237490]
   automated match to d3w1aa_
   complexed with fmn, gol, nco, w7c

Details for d3w7cb_

PDB Entry: 3w7c, 1.75 Å

PDB Description: structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-5-077

PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w7cb_:

Sequence; same for both SEQRES and ATOM records:

>d3w7cb_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

Timeline for d3w7cb_:

• d3w7cb_ is new in SCOPe 2.03-stable
  
• d3w7cb_ appears in SCOPe 2.04
  
• d3w7cb_ appears in the current release, SCOPe 2.08