Lineage for d3w5ka_ (3w5k A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006405Protein Importin beta [48378] (3 species)
  7. 2006408Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2006421Domain d3w5ka_: 3w5k A: [237471]
    automated match to d2p8qa_
    complexed with zn

Details for d3w5ka_

PDB Entry: 3w5k (more details), 2.6 Å

PDB Description: Crystal structure of Snail1 and importin beta complex
PDB Compounds: (A:) Importin subunit beta-1

SCOPe Domain Sequences for d3w5ka_:

Sequence, based on SEQRES records: (download)

>d3w5ka_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
rleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqiknsltskdpdika
qyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaeipvnqwpelipqlv
anvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgmrkeepsnnvklaa
tnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnlvkimslyyqymet
ymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaaeqgrppehtskfy
akgalqylvpiltqtltkqdendddddwnpckaagvclmllatcceddivphvlpfikeh
iknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdpsvvvrdtaawtvgr
icellpeaaindvylapllqclieglsaeprvasnvcwafsslaeaayeaadvaddqeep
atyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsakdcypavqkttlvi
merlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqdalqisdvvmasllrm
fqstagsggvqedalmavstlvevlggeflkymeafkpflgiglknyaeyqvclaavglv
gdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdialaiggefkkylev
vlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdqenvhpdvmlvqprv
efilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpmihelltegrrsk
tnkaktlatwatkelrklknqa

Sequence, based on observed residues (ATOM records): (download)

>d3w5ka_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
rleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglqiknsltskdpdika
qyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacaeipvnqwpelipqlv
anvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqgmrkeepsnnvklaa
tnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqnlvkimslyyqymet
ymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieaseaaeqgrppehtskfy
akgalqylvpiltqtltkqdendddddwnpckaagvclmllatcceddivphvlpfikeh
iknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdpsvvvrdtaawtvgr
icellpeaaindvylapllqclieglsaeprvasnvcwafsslaeaayeaaddqeepaty
clsssfelivqkllettdrpdghqnnlrssayeslmeivknsakdcypavqkttlvimer
lqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqdalqisdvvmasllrmfqs
tagsggvqedalmavstlvevlggeflkymeafkpflgiglknyaeyqvclaavglvgdl
cralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdialaiggefkkylevvln
tlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdqenvhpdvmlvqprvefi
lsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpmihelltegrrsktnk
aktlatwatkelrklknqa

SCOPe Domain Coordinates for d3w5ka_:

Click to download the PDB-style file with coordinates for d3w5ka_.
(The format of our PDB-style files is described here.)

Timeline for d3w5ka_: