Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (19 PDB entries) |
Domain d4ouoa2: 4ouo A:115-231 [237470] automated match to d2ghwb2 complexed with cl, so4 |
PDB Entry: 4ouo (more details), 1.8 Å
SCOPe Domain Sequences for d4ouoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ouoa2 b.1.1.0 (A:115-231) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} avtldesggglqtpggalslvckasgftfsvydmmwvrqapskglewvagigitgstyya savkgratisrdngqstvrlqlnnlraedtgtyycarggaysinkldtwgqgteviv
Timeline for d4ouoa2: