Lineage for d4ouoa1 (4ouo A:-2-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754083Domain d4ouoa1: 4ouo A:-2-107 [237469]
    automated match to d2ghwb1
    complexed with cl, so4

Details for d4ouoa1

PDB Entry: 4ouo (more details), 1.8 Å

PDB Description: anti-Bla g 1 scFv
PDB Compounds: (A:) anti Bla g 1 scFv

SCOPe Domain Sequences for d4ouoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ouoa1 b.1.1.0 (A:-2-107) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sftqaaltqpssvsanpgetvkitcsgggsssnygwfqqkspgsapvtviynnnnrpsdi
psrfsgsksgstatltitgvqaddeavyfcggrdstyagmfgagttltvl

SCOPe Domain Coordinates for d4ouoa1:

Click to download the PDB-style file with coordinates for d4ouoa1.
(The format of our PDB-style files is described here.)

Timeline for d4ouoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ouoa2