Lineage for d4pobb_ (4pob B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134739Species Mycobacterium abscessus [TaxId:561007] [237466] (1 PDB entry)
  8. 2134741Domain d4pobb_: 4pob B: [237468]
    automated match to d1nw2a_
    complexed with edo, na

Details for d4pobb_

PDB Entry: 4pob (more details), 1.7 Å

PDB Description: Crystal structure of a thioredoxin Rv1471 ortholog from Mycobacterium abscessus
PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d4pobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pobb_ c.47.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
atvtvtddsfqedvvssnkpvlvdfwatwcgpckmvapvleeiakdhgealtiakldvda
npetarafqvtsiptlilfqngeatkrivgaksksallreldgvv

SCOPe Domain Coordinates for d4pobb_:

Click to download the PDB-style file with coordinates for d4pobb_.
(The format of our PDB-style files is described here.)

Timeline for d4pobb_: