SCOPe 2.08: Domain d4pnvb1: 4pnv B:1-122

Lineage for d4pnvb1 (4pnv B:1-122)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
   duplication: consists of three domains of this fold

6. Protein DNA polymerase III, beta subunit [55981] (2 species)

7. Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
   Uniprot P00583

8. Domain d4pnvb1: 4pnv B:1-122 [237448]
   automated match to d3d1ga1
   complexed with ca, cl, peg

Details for d4pnvb1

PDB Entry: 4pnv, 1.86 Å

PDB Description: e. coli sliding clamp apo-crystal in p21 space group with larger cell dimensions

PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d4pnvb1:

Sequence; same for both SEQRES and ATOM records:

>d4pnvb1 d.131.1.1 (B:1-122) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

Timeline for d4pnvb1:

• d4pnvb1 first appeared in SCOPe 2.03
  
• d4pnvb1 appears in SCOPe 2.07