Lineage for d4owgb_ (4owg B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 1815295Protein Triosephosphate isomerase [51353] (20 species)
  7. 1815454Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [102035] (4 PDB entries)
  8. 1815460Domain d4owgb_: 4owg B: [237443]
    automated match to d1r2ra_
    complexed with pep

Details for d4owgb_

PDB Entry: 4owg (more details), 1.55 Å

PDB Description: crystal structure of rabbit muscle triosephosphate isomerase-pep complex
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d4owgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4owgb_ c.1.1.1 (B:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
srkffvggnwkmngrkknlgelittlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgesdeligqkvahalseglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinak

SCOPe Domain Coordinates for d4owgb_:

Click to download the PDB-style file with coordinates for d4owgb_.
(The format of our PDB-style files is described here.)

Timeline for d4owgb_: