Lineage for d1f49b3 (1f49 B:3-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774380Domain d1f49b3: 1f49 B:3-219 [23743]
    Other proteins in same PDB: d1f49a1, d1f49a2, d1f49a4, d1f49a5, d1f49b1, d1f49b2, d1f49b4, d1f49b5, d1f49c1, d1f49c2, d1f49c4, d1f49c5, d1f49d1, d1f49d2, d1f49d4, d1f49d5, d1f49e1, d1f49e2, d1f49e4, d1f49e5, d1f49f1, d1f49f2, d1f49f4, d1f49f5, d1f49g1, d1f49g2, d1f49g4, d1f49g5, d1f49h1, d1f49h2, d1f49h4, d1f49h5
    complexed with mg
    complexed with mg

Details for d1f49b3

PDB Entry: 1f49 (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1f49b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f49b3 b.18.1.5 (B:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1f49b3:

Click to download the PDB-style file with coordinates for d1f49b3.
(The format of our PDB-style files is described here.)

Timeline for d1f49b3: