SCOPe 2.04: Domain d4ougb_: 4oug B:

Lineage for d4ougb_ (4oug B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (28 PDB entries)

8. Domain d4ougb_: 4oug B: [237422]
   automated match to d2r90a_
   complexed with gol, lp5, plm, tla

Details for d4ougb_

PDB Entry: 4oug, 2.46 Å

PDB Description: Crystal structure of the ternary complex of camel peptidoglycan recognition protein, PGRP-S with lipopolysaccharide and palmitic acid at 2.46 A resolution

PDB Compounds: (B:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d4ougb_:

Sequence; same for both SEQRES and ATOM records:

>d4ougb_ d.118.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

Timeline for d4ougb_:

• d4ougb_ first appeared in SCOPe 2.03
  
• d4ougb_ appears in SCOPe 2.05
  
• d4ougb_ appears in the current release, SCOPe 2.08