Lineage for d1f49a3 (1f49 A:3-219)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57188Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 57189Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 57225Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 57226Protein beta-Galactosidase [49804] (1 species)
  7. 57227Species Escherichia coli [TaxId:562] [49805] (7 PDB entries)
  8. 57248Domain d1f49a3: 1f49 A:3-219 [23742]
    Other proteins in same PDB: d1f49a1, d1f49a2, d1f49a4, d1f49a5, d1f49b1, d1f49b2, d1f49b4, d1f49b5, d1f49c1, d1f49c2, d1f49c4, d1f49c5, d1f49d1, d1f49d2, d1f49d4, d1f49d5, d1f49e1, d1f49e2, d1f49e4, d1f49e5, d1f49f1, d1f49f2, d1f49f4, d1f49f5, d1f49g1, d1f49g2, d1f49g4, d1f49g5, d1f49h1, d1f49h2, d1f49h4, d1f49h5

Details for d1f49a3

PDB Entry: 1f49 (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1f49a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f49a3 b.18.1.5 (A:3-219) beta-Galactosidase {Escherichia coli}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1f49a3:

Click to download the PDB-style file with coordinates for d1f49a3.
(The format of our PDB-style files is described here.)

Timeline for d1f49a3: