Lineage for d4ouga_ (4oug A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2972808Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2972872Protein automated matches [190549] (4 species)
    not a true protein
  7. 2972875Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries)
  8. 2972988Domain d4ouga_: 4oug A: [237419]
    automated match to d2r90a_
    complexed with gol, lp5, plm, tla

Details for d4ouga_

PDB Entry: 4oug (more details), 2.46 Å

PDB Description: Crystal structure of the ternary complex of camel peptidoglycan recognition protein, PGRP-S with lipopolysaccharide and palmitic acid at 2.46 A resolution
PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d4ouga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ouga_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d4ouga_:

Click to download the PDB-style file with coordinates for d4ouga_.
(The format of our PDB-style files is described here.)

Timeline for d4ouga_: