SCOPe 2.04: Domain d4orvd_: 4orv D:

Lineage for d4orvd_ (4orv D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
   Family 2 zinc amidase;

6. Protein automated matches [190549] (4 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (28 PDB entries)

8. Domain d4orvd_: 4orv D: [237414]
   automated match to d2r90a_
   complexed with gol, nag, tla, xxc

Details for d4orvd_

PDB Entry: 4orv, 2.5 Å

PDB Description: crystal structure of the ternary complex of camel peptidoglycan recognition protein pgrp-s with 7- phenylheptanoic acid and n- acetylglucosamine at 2.50 a resolution

PDB Compounds: (D:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d4orvd_:

Sequence; same for both SEQRES and ATOM records:

>d4orvd_ d.118.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

Timeline for d4orvd_:

• d4orvd_ first appeared in SCOPe 2.03
  
• d4orvd_ appears in SCOPe 2.05
  
• d4orvd_ appears in the current release, SCOPe 2.08