Lineage for d4oppb_ (4opp B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429380Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1429381Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1429382Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1429443Protein automated matches [190549] (3 species)
    not a true protein
  7. 1429444Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (26 PDB entries)
  8. 1429510Domain d4oppb_: 4opp B: [237413]
    automated match to d2r90a_
    complexed with 11z, gol, nag, tla

Details for d4oppb_

PDB Entry: 4opp (more details), 2.3 Å

PDB Description: crystal structure of the ternary complex of camel peptidoglycan recognition protein pgrp-s with 11-cyclohexylundecanoic acid and n- acetylglucosamine at 2.30 a resolution
PDB Compounds: (B:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d4oppb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oppb_ d.118.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d4oppb_:

Click to download the PDB-style file with coordinates for d4oppb_.
(The format of our PDB-style files is described here.)

Timeline for d4oppb_: