Lineage for d1bglh3 (1bgl H:3-219)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777099Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1777100Protein beta-Galactosidase [49804] (2 species)
  7. 1777108Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 1777248Domain d1bglh3: 1bgl H:3-219 [23741]
    Other proteins in same PDB: d1bgla1, d1bgla2, d1bgla4, d1bgla5, d1bglb1, d1bglb2, d1bglb4, d1bglb5, d1bglc1, d1bglc2, d1bglc4, d1bglc5, d1bgld1, d1bgld2, d1bgld4, d1bgld5, d1bgle1, d1bgle2, d1bgle4, d1bgle5, d1bglf1, d1bglf2, d1bglf4, d1bglf5, d1bglg1, d1bglg2, d1bglg4, d1bglg5, d1bglh1, d1bglh2, d1bglh4, d1bglh5
    complexed with mg
    complexed with mg

Details for d1bglh3

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)
PDB Compounds: (H:) beta-galactosidase

SCOPe Domain Sequences for d1bglh3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bglh3 b.18.1.5 (H:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1bglh3:

Click to download the PDB-style file with coordinates for d1bglh3.
(The format of our PDB-style files is described here.)

Timeline for d1bglh3: