SCOPe 2.08: Domain d4ojqb1: 4ojq B:187-325

Lineage for d4ojqb1 (4ojq B:187-325)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (7 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain, N-terminal domain [418962] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [419424] (17 PDB entries)

8. Domain d4ojqb1: 4ojq B:187-325 [237409]
   Other proteins in same PDB: d4ojqa2, d4ojqb2
   automated match to d1cu1a2
   complexed with 2sx, ca

Details for d4ojqb1

PDB Entry: 4ojq, 2.25 Å

PDB Description: Crystal Structure of Hepatitis C Virus NS3 Helicase Inhibitor Co-complex with Fragment 1 [(5-bromo-1H-indol-3-yl)acetic acid]

PDB Compounds: (B:) Serine protease NS3

SCOPe Domain Sequences for d4ojqb1:

Sequence, based on SEQRES records:

>d4ojqb1 c.37.1.14 (B:187-325) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gvdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtv
ldqaetagarlvvlatatp

Sequence, based on observed residues (ATOM records):

>d4ojqb1 c.37.1.14 (B:187-325) HCV helicase domain, N-terminal domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
nssppavpqsfqvahlhapttkvpaayaaqgykvlvlnpsvaatlgfgaymskahspity
stygkfladggcsggaydiiicdechstdatsilgigtvldqaetagarlvvlatatp

Timeline for d4ojqb1:

• d4ojqb1 first appeared in SCOPe 2.03
  
• d4ojqb1 appears in SCOPe 2.07