![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
![]() | Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
![]() | Protein automated matches [237402] (1 species) not a true protein |
![]() | Species Burkholderia thailandensis [TaxId:271848] [237403] (1 PDB entry) |
![]() | Domain d4oj7c_: 4oj7 C: [237404] automated match to d2f6la1 complexed with edo, no3 |
PDB Entry: 4oj7 (more details), 2.15 Å
SCOPe Domain Sequences for d4oj7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oj7c_ a.130.1.0 (C:) automated matches {Burkholderia thailandensis [TaxId: 271848]} ddtaltnlvalasqrlalaepvahwkwinrkpisdppreaalltdvekratangvdpaya rtffddqiaaskqlqnalfatwrathgpegpapdlatstrpqldrltqsliaalarvapl rdapdcpsrlarsianwktltrydsaqkdalgtalshvcaagg
Timeline for d4oj7c_: