SCOPe 2.08: Domain d4nrzb2: 4nrz B:108-212

Lineage for d4nrzb2 (4nrz B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4nrzb2: 4nrz B:108-212 [237400]
   Other proteins in same PDB: d4nrza_, d4nrzb1, d4nrzh_, d4nrzl1
   automated match to d4nrzl2
   complexed with zn

Details for d4nrzb2

PDB Entry: 4nrz, 2.42 Å

PDB Description: crystal structure of hiv-1 neutralizing antibody m66.6

PDB Compounds: (B:) m66.6 light chain

SCOPe Domain Sequences for d4nrzb2:

Sequence; same for both SEQRES and ATOM records:

>d4nrzb2 b.1.1.2 (B:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4nrzb2:

• d4nrzb2 first appeared in SCOPe 2.03
  
• d4nrzb2 appears in SCOPe 2.07