Lineage for d4oa5f_ (4oa5 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894487Species Anaplasma phagocytophilum [TaxId:212042] [236090] (2 PDB entries)
  8. 2894495Domain d4oa5f_: 4oa5 F: [237396]
    automated match to d4oa8a_
    complexed with edo, gol, iod, sah

Details for d4oa5f_

PDB Entry: 4oa5 (more details), 2.3 Å

PDB Description: x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah solved by iodide sad phasing
PDB Compounds: (F:) O-methyltransferase family protein

SCOPe Domain Sequences for d4oa5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oa5f_ c.66.1.0 (F:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
lskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsivevgt
cvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaqlntlk
emapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvssnaha
smrafndelankekylstiiptsegmmvsiklt

SCOPe Domain Coordinates for d4oa5f_:

Click to download the PDB-style file with coordinates for d4oa5f_.
(The format of our PDB-style files is described here.)

Timeline for d4oa5f_: