Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
Protein automated matches [190689] (42 species) not a true protein |
Species Anaplasma phagocytophilum [TaxId:212042] [236090] (2 PDB entries) |
Domain d4oa5a_: 4oa5 A: [237391] automated match to d4oa8a_ complexed with edo, gol, iod, sah |
PDB Entry: 4oa5 (more details), 2.3 Å
SCOPe Domain Sequences for d4oa5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oa5a_ c.66.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} skqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsivevgtc vgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaqlntlke mapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvssnahas mrafndelankekylstiiptsegmmvsiklt
Timeline for d4oa5a_: