SCOPe 2.06: Domain d4oa5d_: 4oa5 D:

Lineage for d4oa5d_ (4oa5 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (64 species)
   not a true protein

7. Species Anaplasma phagocytophilum [TaxId:212042] [236090] (2 PDB entries)

8. Domain d4oa5d_: 4oa5 D: [237390]
   automated match to d4oa8a_
   complexed with edo, gol, iod, sah

Details for d4oa5d_

PDB Entry: 4oa5, 2.3 Å

PDB Description: x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sah solved by iodide sad phasing

PDB Compounds: (D:) O-methyltransferase family protein

SCOPe Domain Sequences for d4oa5d_:

Sequence; same for both SEQRES and ATOM records:

>d4oa5d_ c.66.1.0 (D:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
lskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsivevgt
cvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaqlntlk
emapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvssnaha
smrafndelankekylstiiptsegmmvsiklt

Timeline for d4oa5d_:

• d4oa5d_ first appeared in SCOPe 2.03
  
• d4oa5d_ appears in SCOPe 2.05
  
• d4oa5d_ appears in SCOPe 2.07
  
• d4oa5d_ appears in the current release, SCOPe 2.08