SCOPe 2.08: Domain d4o4hb2: 4o4h B:246-440

Lineage for d4o4hb2 (4o4h B:246-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

8. Domain d4o4hb2: 4o4h B:246-440 [237369]
   Other proteins in same PDB: d4o4ha1, d4o4hb1, d4o4hc1, d4o4hd1, d4o4he_, d4o4hf1, d4o4hf2, d4o4hf3
   automated match to d4i4td2
   complexed with acp, ca, gdp, gol, gtp, llm, mg

Details for d4o4hb2

PDB Entry: 4o4h, 2.1 Å

PDB Description: Tubulin-Laulimalide complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4o4hb2:

Sequence, based on SEQRES records:

>d4o4hb2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdata

Sequence, based on observed residues (ATOM records):

>d4o4hb2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
ata

Timeline for d4o4hb2:

• d4o4hb2 first appeared in SCOPe 2.03
  
• d4o4hb2 appears in SCOPe 2.07