Lineage for d4o4hb2 (4o4h B:246-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959296Domain d4o4hb2: 4o4h B:246-440 [237369]
    Other proteins in same PDB: d4o4ha1, d4o4hb1, d4o4hc1, d4o4hd1, d4o4he_, d4o4hf1, d4o4hf2, d4o4hf3
    automated match to d4i4td2
    complexed with acp, ca, gdp, gol, gtp, llm, mg

Details for d4o4hb2

PDB Entry: 4o4h (more details), 2.1 Å

PDB Description: Tubulin-Laulimalide complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4o4hb2:

Sequence, based on SEQRES records: (download)

>d4o4hb2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdata

Sequence, based on observed residues (ATOM records): (download)

>d4o4hb2 d.79.2.1 (B:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
ata

SCOPe Domain Coordinates for d4o4hb2:

Click to download the PDB-style file with coordinates for d4o4hb2.
(The format of our PDB-style files is described here.)

Timeline for d4o4hb2: