Lineage for d4o4hd1 (4o4h D:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2471590Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)
  8. 2471665Domain d4o4hd1: 4o4h D:1-245 [237362]
    Other proteins in same PDB: d4o4ha2, d4o4hb2, d4o4hc2, d4o4hd2, d4o4he_, d4o4hf1, d4o4hf2, d4o4hf3
    automated match to d4i4td1
    complexed with acp, ca, gdp, gol, gtp, llm, mg

Details for d4o4hd1

PDB Entry: 4o4h (more details), 2.1 Å

PDB Description: Tubulin-Laulimalide complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4o4hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4hd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d4o4hd1:

Click to download the PDB-style file with coordinates for d4o4hd1.
(The format of our PDB-style files is described here.)

Timeline for d4o4hd1: