![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (11 PDB entries) |
![]() | Domain d4o4ha2: 4o4h A:246-439 [237360] Other proteins in same PDB: d4o4ha1, d4o4hb1, d4o4hc1, d4o4hd1, d4o4he_ automated match to d3rycc2 complexed with acp, ca, gdp, gol, gtp, llm, mg |
PDB Entry: 4o4h (more details), 2.1 Å
SCOPe Domain Sequences for d4o4ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4ha2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvds
Timeline for d4o4ha2: