Lineage for d4o2ab2 (4o2a B:246-438)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959666Domain d4o2ab2: 4o2a B:246-438 [237355]
    Other proteins in same PDB: d4o2aa1, d4o2ab1, d4o2ac1, d4o2ad1, d4o2ae_, d4o2af1, d4o2af2, d4o2af3
    automated match to d4i4td2
    complexed with 2rr, adp, ca, cl, gdp, gol, gtp, imd, mes, mg

Details for d4o2ab2

PDB Entry: 4o2a (more details), 2.5 Å

PDB Description: tubulin-bal27862 complex
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d4o2ab2:

Sequence, based on SEQRES records: (download)

>d4o2ab2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records): (download)

>d4o2ab2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda

SCOPe Domain Coordinates for d4o2ab2:

Click to download the PDB-style file with coordinates for d4o2ab2.
(The format of our PDB-style files is described here.)

Timeline for d4o2ab2: