![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries) |
![]() | Domain d4o2aa2: 4o2a A:246-437 [237351] Other proteins in same PDB: d4o2aa1, d4o2ab1, d4o2ac1, d4o2ad1, d4o2ae_, d4o2af1, d4o2af2, d4o2af3 automated match to d3ryca2 complexed with 2rr, adp, ca, cl, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 4o2a (more details), 2.5 Å
SCOPe Domain Sequences for d4o2aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o2aa2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d4o2aa2: