SCOPe 2.03: Domain d4o2ac1: 4o2a C:1-245

Lineage for d4o2ac1 (4o2a C:1-245)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (11 PDB entries)

8. Domain d4o2ac1: 4o2a C:1-245 [237347]
   Other proteins in same PDB: d4o2aa2, d4o2ab2, d4o2ac2, d4o2ad2, d4o2ae_
   automated match to d3ryha1
   complexed with 2rr, adp, ca, cl, gdp, gol, gtp, imd, mes, mg

Details for d4o2ac1

PDB Entry: 4o2a, 2.5 Å

PDB Description: tubulin-bal27862 complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4o2ac1:

Sequence; same for both SEQRES and ATOM records:

>d4o2ac1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d4o2ac1:

• d4o2ac1 is new in SCOPe 2.03-stable
  
• d4o2ac1 appears in SCOPe 2.04
  
• d4o2ac1 appears in the current release, SCOPe 2.08