Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (6 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226564] (16 PDB entries) |
Domain d4o2bb1: 4o2b B:1-245 [237346] Other proteins in same PDB: d4o2ba2, d4o2bb2, d4o2bc2, d4o2bd2, d4o2be_ automated match to d4i4td1 complexed with acp, ca, gdp, gol, gtp, imd, loc, mes, mg, peg |
PDB Entry: 4o2b (more details), 2.3 Å
SCOPe Domain Sequences for d4o2bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o2bb1 c.32.1.1 (B:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d4o2bb1: