SCOPe 2.05: Domain d4o2bc2: 4o2b C:246-440

Lineage for d4o2bc2 (4o2b C:246-440)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (16 PDB entries)

8. Domain d4o2bc2: 4o2b C:246-440 [237344]
   Other proteins in same PDB: d4o2ba1, d4o2bb1, d4o2bc1, d4o2bd1, d4o2be_
   automated match to d3ryha2
   complexed with acp, ca, gdp, gol, gtp, imd, loc, mes, mg, peg

Details for d4o2bc2

PDB Entry: 4o2b, 2.3 Å

PDB Description: Tubulin-Colchicine complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4o2bc2:

Sequence; same for both SEQRES and ATOM records:

>d4o2bc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d4o2bc2:

• d4o2bc2 first appeared in SCOPe 2.03
  
• d4o2bc2 appears in SCOPe 2.04
  
• d4o2bc2 appears in SCOPe 2.06
  
• d4o2bc2 appears in the current release, SCOPe 2.08