Lineage for d4o2ba1 (4o2b A:1-245)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361112Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1361113Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1361114Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 1361222Protein automated matches [226837] (3 species)
    not a true protein
  7. 1361223Species Cow (Bos taurus) [TaxId:9913] [226564] (11 PDB entries)
  8. 1361252Domain d4o2ba1: 4o2b A:1-245 [237343]
    Other proteins in same PDB: d4o2ba2, d4o2bb2, d4o2bc2, d4o2bd2, d4o2be_
    automated match to d3rycc1
    complexed with acp, ca, gdp, gol, gtp, imd, loc, mes, mg, peg

Details for d4o2ba1

PDB Entry: 4o2b (more details), 2.3 Å

PDB Description: Tubulin-Colchicine complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4o2ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o2ba1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d4o2ba1:

Click to download the PDB-style file with coordinates for d4o2ba1.
(The format of our PDB-style files is described here.)

Timeline for d4o2ba1: