Lineage for d4o2be_ (4o2b E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016485Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2016486Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2016487Protein Stathmin 4 [101496] (1 species)
  7. 2016488Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries)
  8. 2016504Domain d4o2be_: 4o2b E: [237341]
    Other proteins in same PDB: d4o2ba1, d4o2ba2, d4o2bb1, d4o2bb2, d4o2bc1, d4o2bc2, d4o2bd1, d4o2bd2, d4o2bf1, d4o2bf2
    automated match to d4ihje_
    complexed with acp, ca, gdp, gol, gtp, imd, loc, mes, mg, peg

Details for d4o2be_

PDB Entry: 4o2b (more details), 2.3 Å

PDB Description: Tubulin-Colchicine complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4o2be_:

Sequence, based on SEQRES records: (download)

>d4o2be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d4o2be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d4o2be_:

Click to download the PDB-style file with coordinates for d4o2be_.
(The format of our PDB-style files is described here.)

Timeline for d4o2be_: