Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries) |
Domain d4o2be_: 4o2b E: [237341] Other proteins in same PDB: d4o2ba1, d4o2ba2, d4o2bb1, d4o2bb2, d4o2bc1, d4o2bc2, d4o2bd1, d4o2bd2, d4o2bf1, d4o2bf2 automated match to d4ihje_ complexed with acp, ca, gdp, gol, gtp, imd, loc, mes, mg, peg |
PDB Entry: 4o2b (more details), 2.3 Å
SCOPe Domain Sequences for d4o2be_:
Sequence, based on SEQRES records: (download)
>d4o2be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d4o2be_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d4o2be_: