Lineage for d4niqb_ (4niq B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696892Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2696909Family a.7.14.0: automated matches [191520] (1 protein)
    not a true family
  6. 2696910Protein automated matches [190877] (3 species)
    not a true protein
  7. 2696917Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [237334] (1 PDB entry)
  8. 2696919Domain d4niqb_: 4niq B: [237336]
    automated match to d1yxra1

Details for d4niqb_

PDB Entry: 4niq (more details), 2.3 Å

PDB Description: crystal structure of vps4 mit-vfa1 mim2
PDB Compounds: (B:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d4niqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4niqb_ a.7.14.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakftey
lnraeqlkkhleseeana

SCOPe Domain Coordinates for d4niqb_:

Click to download the PDB-style file with coordinates for d4niqb_.
(The format of our PDB-style files is described here.)

Timeline for d4niqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4niqa_