| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.14: MIT domain [116846] (2 families) ![]() |
| Family a.7.14.0: automated matches [191520] (1 protein) not a true family |
| Protein automated matches [190877] (3 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [237334] (1 PDB entry) |
| Domain d4niqb_: 4niq B: [237336] automated match to d1yxra1 |
PDB Entry: 4niq (more details), 2.3 Å
SCOPe Domain Sequences for d4niqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4niqb_ a.7.14.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlirakftey
lnraeqlkkhleseeana
Timeline for d4niqb_: