SCOPe 2.05: Domain d4mtca_: 4mtc A:

Lineage for d4mtca_ (4mtc A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (40 PDB entries)
   Uniprot Q99497

8. Domain d4mtca_: 4mtc A: [237325]
   automated match to d1q2ua_
   complexed with edo

Details for d4mtca_

PDB Entry: 4mtc, 1.47 Å

PDB Description: Crystal structure of human C53A DJ-1

PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d4mtca_:

Sequence; same for both SEQRES and ATOM records:

>d4mtca_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvviapdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d4mtca_:

• d4mtca_ first appeared in SCOPe 2.03
  
• d4mtca_ appears in SCOPe 2.04
  
• d4mtca_ appears in SCOPe 2.06
  
• d4mtca_ appears in the current release, SCOPe 2.08