Lineage for d4mqpa_ (4mqp A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149015Species Mycobacterium tuberculosis [TaxId:1773] [225404] (27 PDB entries)
  8. 2149040Domain d4mqpa_: 4mqp A: [237321]
    automated match to d3tfta_
    complexed with 2b1, edo, peg

Details for d4mqpa_

PDB Entry: 4mqp (more details), 1.83 Å

PDB Description: Mycobaterium tuberculosis transaminase BioA complexed with 2-hydrazinylbenzo[d]thiazole
PDB Compounds: (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d4mqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mqpa_ c.67.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta
ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs
vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf
apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry
evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa
gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd
vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv
evarlvgs

SCOPe Domain Coordinates for d4mqpa_:

Click to download the PDB-style file with coordinates for d4mqpa_.
(The format of our PDB-style files is described here.)

Timeline for d4mqpa_: