Lineage for d1bgmn3 (1bgm N:3-219)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12057Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
  4. 12058Superfamily b.18.1: Galactose-binding domain-like [49785] (8 families) (S)
  5. 12089Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (2 proteins)
  6. 12090Protein beta-Galactosidase [49804] (1 species)
  7. 12091Species Escherichia coli [TaxId:562] [49805] (7 PDB entries)
  8. 12109Domain d1bgmn3: 1bgm N:3-219 [23731]
    Other proteins in same PDB: d1bgmi1, d1bgmi2, d1bgmi4, d1bgmi5, d1bgmj1, d1bgmj2, d1bgmj4, d1bgmj5, d1bgmk1, d1bgmk2, d1bgmk4, d1bgmk5, d1bgml1, d1bgml2, d1bgml4, d1bgml5, d1bgmm1, d1bgmm2, d1bgmm4, d1bgmm5, d1bgmn1, d1bgmn2, d1bgmn4, d1bgmn5, d1bgmo1, d1bgmo2, d1bgmo4, d1bgmo5, d1bgmp1, d1bgmp2, d1bgmp4, d1bgmp5

Details for d1bgmn3

PDB Entry: 1bgm (more details), 2.5 Å

PDB Description: beta-galactosidase (chains i-p)

SCOP Domain Sequences for d1bgmn3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgmn3 b.18.1.5 (N:3-219) beta-Galactosidase {Escherichia coli}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOP Domain Coordinates for d1bgmn3:

Click to download the PDB-style file with coordinates for d1bgmn3.
(The format of our PDB-style files is described here.)

Timeline for d1bgmn3: