SCOPe 2.05: Domain d4metd_: 4met D:

Lineage for d4metd_ (4met D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein automated matches [190784] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [237304] (1 PDB entry)

8. Domain d4metd_: 4met D: [237309]
   automated match to d2uyaa_
   complexed with co

Details for d4metd_

PDB Entry: 4met, 2.1 Å

PDB Description: assigning the epr fine structure parameters of the mn(ii) centers in bacillus subtilis oxalate decarboxylase by site-directed mutagenesis and dft/mm calculations

PDB Compounds: (D:) oxalate decarboxylase oxdc

SCOPe Domain Sequences for d4metd_:

Sequence; same for both SEQRES and ATOM records:

>d4metd_ b.82.1.2 (D:) automated matches {Bacillus subtilis [TaxId: 224308]}
dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
vgegdlfyfpsglphsiqaleegaefllvfddgsfsenstfqltdwlahtpkeviaanfg
vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi
adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny
qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk
dftdvlskekhpvvkkk

Timeline for d4metd_:

• d4metd_ first appeared in SCOPe 2.03
  
• d4metd_ appears in SCOPe 2.04
  
• d4metd_ appears in SCOPe 2.06
  
• d4metd_ appears in the current release, SCOPe 2.08