SCOPe 2.08: Domain d4m7ua1: 4m7u A:1-162

Lineage for d4m7ua1 (4m7u A:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [237300] (2 PDB entries)

8. Domain d4m7ua1: 4m7u A:1-162 [237303]
   Other proteins in same PDB: d4m7ua2
   automated match to d4elha_
   complexed with nap

Details for d4m7ua1

PDB Entry: 4m7u, 2.1 Å

PDB Description: Dihydrofolate reductase from Enterococcus faecalis complexed with NADP(H)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4m7ua1:

Sequence; same for both SEQRES and ATOM records:

>d4m7ua1 c.71.1.0 (A:1-162) automated matches {Enterococcus faecalis [TaxId: 226185]}
mlaaiwaqdeqgvigkegklpwhlpndlkffkektihntlvlgratfegmgcrplpnrtt
ivltsnpdyqaegvlvmhsveeilayadkyegvtvigggsvvfkelipacdvlyrtmihe
tfegdtffpeidwsvwekvatvpgvvdeknlyahdyetyhrn

Timeline for d4m7ua1:

• d4m7ua1 first appeared in SCOPe 2.03, called d4m7ua_
  
• d4m7ua1 appears in SCOPe 2.07